Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
Protein automated matches [191112] (17 species) not a true protein |
Species Porphyromonas gingivalis [TaxId:242619] [225221] (1 PDB entry) |
Domain d2nvvc1: 2nvv C:2-218 [205189] automated match to d2g39a1 complexed with zn |
PDB Entry: 2nvv (more details), 2.7 Å
SCOPe Domain Sequences for d2nvvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvvc1 c.124.1.0 (C:2-218) automated matches {Porphyromonas gingivalis [TaxId: 242619]} alrfitaeeaaefvhhndnvgfsgftpagnpkvvpaaiakraiaahekgnpfkigmftga stgarldgvlaqadavkfrtpyqsnkdlrnlinngstsyfdlhlstlaqdlrygfygkvd vaiievadvtedgkilpttgvgilpticrladriivelndkhpkeimgmhdlcepldppa rrelpvytpsdrigkpyvqvdpakivgvvrtsepnde
Timeline for d2nvvc1: