Lineage for d2nvva2 (2nvv A:219-497)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529545Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2529546Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2529832Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2529833Protein automated matches [191112] (16 species)
    not a true protein
  7. 2529963Species Porphyromonas gingivalis [TaxId:242619] [225221] (1 PDB entry)
  8. 2529965Domain d2nvva2: 2nvv A:219-497 [205186]
    automated match to d2g39a2
    complexed with zn

Details for d2nvva2

PDB Entry: 2nvv (more details), 2.7 Å

PDB Description: Crystal Structure of the Putative Acetyl-CoA hydrolase/transferase PG1013 from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR16.
PDB Compounds: (A:) Acetyl-CoA hydrolase/transferase family protein

SCOPe Domain Sequences for d2nvva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvva2 c.124.1.0 (A:219-497) automated matches {Porphyromonas gingivalis [TaxId: 242619]}
sdfapldpvtqaigdnvaaflvsemkagripkdflplqsgvgnvanavlgalgdnpdipa
fnmyteviqdavialmkkgrikfasgcslsvsrsviqdiyanldffkdkillrpqeysnn
peivrrlgvitintaleadifgninsthvsgtrmmngiggsgdftrnsyvsifttpsvmk
dgkissfvpmvahhdhsehsvkviisewgvadlrgknpreraheiidkcvhpdyrpllrq
ylelgvkgqtpqnldccfafhqelaksgdmrnvrwedym

SCOPe Domain Coordinates for d2nvva2:

Click to download the PDB-style file with coordinates for d2nvva2.
(The format of our PDB-style files is described here.)

Timeline for d2nvva2: