SCOPe 2.06: Domain d2nv5a_: 2nv5 A:

Lineage for d2nv5a_ (2nv5 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (8 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225183] (2 PDB entries)

8. Domain d2nv5a_: 2nv5 A: [205182]
   automated match to d2ooqb_

Details for d2nv5a_

PDB Entry: 2nv5, 2 Å

PDB Description: crystal structure of a c-terminal phosphatase domain of rattus norvegicus ortholog of human protein tyrosine phosphatase, receptor type, d (ptprd)

PDB Compounds: (A:) ptprd, phosphatase

SCOPe Domain Sequences for d2nv5a_:

Sequence; same for both SEQRES and ATOM records:

>d2nv5a_ c.45.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
shppipileladhierlkandnlkfsqeyesidpgqqftwehsnlevnkpknryanviay
dhsrvllsaiegipgsdyvnanyidgyrkqnayiatqgslpetfgdfwrmiweqrsatvv
mmtkleersrvkcdqywpsrgtethglvqvtlldtvelatycvrtfalykngssekrevr
qfqftawpdhgvpehptpflaflrrvktcnppdagpmvvhcsagvgrtgcfividamler
ikhektvdiyghvtlmraqrnymvqtedqyifihdalleavtc

Timeline for d2nv5a_:

• d2nv5a_ first appeared in SCOPe 2.03
  
• d2nv5a_ appears in SCOPe 2.05
  
• d2nv5a_ appears in SCOPe 2.07
  
• d2nv5a_ appears in the current release, SCOPe 2.08