Lineage for d2nttb2 (2ntt B:87-217)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403556Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1403557Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1403757Protein automated matches [226944] (2 species)
    not a true protein
  7. 1403763Species Staphylococcus aureus [TaxId:93062] [225287] (2 PDB entries)
  8. 1403765Domain d2nttb2: 2ntt B:87-217 [205181]
    Other proteins in same PDB: d2ntta1, d2nttb1
    automated match to d2g9hd2
    complexed with cl, edo

Details for d2nttb2

PDB Entry: 2ntt (more details), 1.56 Å

PDB Description: Crystal Structure of SEK
PDB Compounds: (B:) Staphylococcal enterotoxin K

SCOPe Domain Sequences for d2nttb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nttb2 d.15.6.1 (B:87-217) automated matches {Staphylococcus aureus [TaxId: 93062]}
eyldksrnipiniwingnhktistnkvstnkkfvtaqeidvklrkylqeeyniyghngtk
kgeeyghkskfysgfnigkvtfhlnnndtfsydlfytgddglpksflkiyednktvesek
fhldvdisyka

SCOPe Domain Coordinates for d2nttb2:

Click to download the PDB-style file with coordinates for d2nttb2.
(The format of our PDB-style files is described here.)

Timeline for d2nttb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nttb1