Lineage for d2ntta2 (2ntt A:87-216)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934366Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2934575Protein automated matches [226944] (2 species)
    not a true protein
  7. 2934580Species Staphylococcus aureus [TaxId:93062] [225287] (3 PDB entries)
  8. 2934581Domain d2ntta2: 2ntt A:87-216 [205179]
    Other proteins in same PDB: d2ntta1, d2ntta3, d2nttb1, d2nttb3
    automated match to d2g9hd2
    complexed with cl, edo

Details for d2ntta2

PDB Entry: 2ntt (more details), 1.56 Å

PDB Description: Crystal Structure of SEK
PDB Compounds: (A:) Staphylococcal enterotoxin K

SCOPe Domain Sequences for d2ntta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntta2 d.15.6.1 (A:87-216) automated matches {Staphylococcus aureus [TaxId: 93062]}
eyldksrnipiniwingnhktistnkvstnkkfvtaqeidvklrkylqeeyniyghngtk
kgeeyghkskfysgfnigkvtfhlnnndtfsydlfytgddglpksflkiyednktvesek
fhldvdisyk

SCOPe Domain Coordinates for d2ntta2:

Click to download the PDB-style file with coordinates for d2ntta2.
(The format of our PDB-style files is described here.)

Timeline for d2ntta2: