Lineage for d2ntib1 (2nti B:1-127)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583764Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2583765Protein automated matches [226907] (28 species)
    not a true protein
  7. 2584028Species Sulfolobus solfataricus [TaxId:273057] [225354] (3 PDB entries)
  8. 2584037Domain d2ntib1: 2nti B:1-127 [205162]
    automated match to d1ud9a1
    complexed with 7pg, br, k

Details for d2ntib1

PDB Entry: 2nti (more details), 2.5 Å

PDB Description: crystal structure of pcna123 heterotrimer.
PDB Compounds: (B:) DNA polymerase sliding clamp c

SCOPe Domain Sequences for d2ntib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntib1 d.131.1.0 (B:1-127) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mmkakvidavsfsyilrtvgdflseanfivtkegirvsgidpsrvvfldiflpssyfegf
evsqekeiigfkledvndilkrvlkddtlilssneskltltfdgeftrsfelpliqvest
qppsvnl

SCOPe Domain Coordinates for d2ntib1:

Click to download the PDB-style file with coordinates for d2ntib1.
(The format of our PDB-style files is described here.)

Timeline for d2ntib1: