Lineage for d2nt4a1 (2nt4 A:1-124)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856040Species Myxococcus xanthus [TaxId:34] [225234] (4 PDB entries)
  8. 2856042Domain d2nt4a1: 2nt4 A:1-124 [205157]
    Other proteins in same PDB: d2nt4a2
    automated match to d2iynb_
    complexed with cl; mutant

Details for d2nt4a1

PDB Entry: 2nt4 (more details), 1.02 Å

PDB Description: receiver domain from myxococcus xanthus social motility protein frzs (h92f mutant)
PDB Compounds: (A:) response regulator homolog

SCOPe Domain Sequences for d2nt4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nt4a1 c.23.1.0 (A:1-124) automated matches {Myxococcus xanthus [TaxId: 34]}
mskkilivesdtalsatlrsalegrgftvdettdgkgsveqirrdrpdlvvlavdlsagq
ngylicgklkkdddlknvpiviignpdgfaqfrklkahadeyvakpvdadqlveragali
gfpe

SCOPe Domain Coordinates for d2nt4a1:

Click to download the PDB-style file with coordinates for d2nt4a1.
(The format of our PDB-style files is described here.)

Timeline for d2nt4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nt4a2