SCOPe 2.08: Domain d2nt4a1: 2nt4 A:1-124

Lineage for d2nt4a1 (2nt4 A:1-124)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Myxococcus xanthus [TaxId:34] [225234] (4 PDB entries)

8. Domain d2nt4a1: 2nt4 A:1-124 [205157]
   Other proteins in same PDB: d2nt4a2
   automated match to d2iynb_
   complexed with cl; mutant

Details for d2nt4a1

PDB Entry: 2nt4, 1.02 Å

PDB Description: receiver domain from myxococcus xanthus social motility protein frzs (h92f mutant)

PDB Compounds: (A:) response regulator homolog

SCOPe Domain Sequences for d2nt4a1:

Sequence; same for both SEQRES and ATOM records:

>d2nt4a1 c.23.1.0 (A:1-124) automated matches {Myxococcus xanthus [TaxId: 34]}
mskkilivesdtalsatlrsalegrgftvdettdgkgsveqirrdrpdlvvlavdlsagq
ngylicgklkkdddlknvpiviignpdgfaqfrklkahadeyvakpvdadqlveragali
gfpe

Timeline for d2nt4a1:

• d2nt4a1 first appeared in SCOPe 2.03, called d2nt4a_
  
• d2nt4a1 appears in SCOPe 2.07