![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
![]() | Protein automated matches [190497] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries) |
![]() | Domain d2nsqa_: 2nsq A: [205155] automated match to d3kwta_ complexed with edo, gol |
PDB Entry: 2nsq (more details), 1.85 Å
SCOPe Domain Sequences for d2nsqa_:
Sequence, based on SEQRES records: (download)
>d2nsqa_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gepvyglsedegesrilrvkvvsgidlakkdifgasdpyvklslyvadenrelalvqtkt ikktlnpkwneefyfrvnpsnhrllfevfdenrltrddflgqvdvplshlptedptmerp ytfkdfllrprshksrvkgflrlkmaymp
>d2nsqa_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gepvyglsedegesrilrvkvvsgidlakkasdpyvklslyvadenrelalvqtktikkt lnpkwneefyfrvnpsnhrllfevfdenrltrddflgqvdvplshlptedpytfkdfllr prshksrvkgflrlkmaymp
Timeline for d2nsqa_: