Lineage for d2ns7d2 (2ns7 D:68-205)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1746767Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1746768Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1746769Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1746971Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 1746972Species Escherichia coli [TaxId:562] [48501] (23 PDB entries)
  8. 1746997Domain d2ns7d2: 2ns7 D:68-205 [205154]
    Other proteins in same PDB: d2ns7a1, d2ns7b1, d2ns7c1, d2ns7d1
    automated match to d1qpia2

Details for d2ns7d2

PDB Entry: 2ns7 (more details), 2.4 Å

PDB Description: how an in vitro selected peptide mimics the antibiotic tetracycline to induce tet repressor
PDB Compounds: (D:) Tetracycline repressor protein

SCOPe Domain Sequences for d2ns7d2:

Sequence, based on SEQRES records: (download)

>d2ns7d2 a.121.1.1 (D:68-205) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
splegeswqdflrnnaksfrnallshrdgakvhlgtrptekqyetlenqlafltqqgfsl
enalyalsavghftlgsvledqehqvakeeretpttdsmppllrqaielfdhqgaepafl
hgleslirgfevqltall

Sequence, based on observed residues (ATOM records): (download)

>d2ns7d2 a.121.1.1 (D:68-205) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
splegeswqdflrnnaksfrnallshrdgakvhlgtrptekqyetlenqlafltqqgfsl
enalyalsavghftlgsvledqehqvakegaepaflhgleslirgfevqltall

SCOPe Domain Coordinates for d2ns7d2:

Click to download the PDB-style file with coordinates for d2ns7d2.
(The format of our PDB-style files is described here.)

Timeline for d2ns7d2: