![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
![]() | Species Llama (Lama glama) [TaxId:9844] [88565] (7 PDB entries) |
![]() | Domain d1qd0a1: 1qd0 A:6-128 [20515] Other proteins in same PDB: d1qd0a2 anti-RR6 VH domain complexed with cu, rr6 |
PDB Entry: 1qd0 (more details), 2.5 Å
SCOPe Domain Sequences for d1qd0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qd0a1 b.1.1.1 (A:6-128) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} esggglvqaggslrlscaasgraasghghygmgwfrqvpgkerefvaairwsgketwykd svkgrftisrdnakttvylqmnslkgedtavyycaarpvrvadislpvgfdywgqgtqvt vss
Timeline for d1qd0a1: