Lineage for d1qd0a_ (1qd0 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287449Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 1287487Species Llama (Lama glama) [TaxId:9844] [88565] (8 PDB entries)
  8. 1287493Domain d1qd0a_: 1qd0 A: [20515]
    anti-RR6 VH domain
    complexed with cu, rr6

Details for d1qd0a_

PDB Entry: 1qd0 (more details), 2.5 Å

PDB Description: camelid heavy chain variable domains provide efficient combining sites to haptens
PDB Compounds: (A:) vhh-r2 anti-rr6 antibody

SCOPe Domain Sequences for d1qd0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qd0a_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgraasghghygmgwfrqvpgkerefvaairwsgke
twykdsvkgrftisrdnakttvylqmnslkgedtavyycaarpvrvadislpvgfdywgq
gtqvtvss

SCOPe Domain Coordinates for d1qd0a_:

Click to download the PDB-style file with coordinates for d1qd0a_.
(The format of our PDB-style files is described here.)

Timeline for d1qd0a_: