Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
Species Llama (Lama glama) [TaxId:9844] [88565] (8 PDB entries) |
Domain d1qd0a_: 1qd0 A: [20515] anti-RR6 VH domain complexed with cu, rr6 |
PDB Entry: 1qd0 (more details), 2.5 Å
SCOPe Domain Sequences for d1qd0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qd0a_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} qvqlqesggglvqaggslrlscaasgraasghghygmgwfrqvpgkerefvaairwsgke twykdsvkgrftisrdnakttvylqmnslkgedtavyycaarpvrvadislpvgfdywgq gtqvtvss
Timeline for d1qd0a_: