Lineage for d1qd0a_ (1qd0 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287101Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)
  7. 287128Species Llama (Lama glama) [TaxId:9844] [88565] (6 PDB entries)
  8. 287133Domain d1qd0a_: 1qd0 A: [20515]
    anti-RR6 VH domain
    complexed with cu, rr6

Details for d1qd0a_

PDB Entry: 1qd0 (more details), 2.5 Å

PDB Description: camelid heavy chain variable domains provide efficient combining sites to haptens

SCOP Domain Sequences for d1qd0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qd0a_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama)}
qvqlqesggglvqaggslrlscaasgraasghghygmgwfrqvpgkerefvaairwsgke
twykdsvkgrftisrdnakttvylqmnslkgedtavyycaarpvrvadislpvgfdywgq
gtqvtvss

SCOP Domain Coordinates for d1qd0a_:

Click to download the PDB-style file with coordinates for d1qd0a_.
(The format of our PDB-style files is described here.)

Timeline for d1qd0a_: