Lineage for d1qd0a_ (1qd0 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 8004Species Llama (Lama glama), anti-RR6 VH domain [48918] (1 PDB entry)
  8. 8005Domain d1qd0a_: 1qd0 A: [20515]

Details for d1qd0a_

PDB Entry: 1qd0 (more details), 2.5 Å

PDB Description: camelid heavy chain variable domains provide efficient combining sites to haptens

SCOP Domain Sequences for d1qd0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qd0a_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Llama (Lama glama), anti-RR6 VH domain}
qvqlqesggglvqaggslrlscaasgraasghghygmgwfrqvpgkerefvaairwsgke
twykdsvkgrftisrdnakttvylqmnslkgedtavyycaarpvrvadislpvgfdywgq
gtqvtvss

SCOP Domain Coordinates for d1qd0a_:

Click to download the PDB-style file with coordinates for d1qd0a_.
(The format of our PDB-style files is described here.)

Timeline for d1qd0a_: