Lineage for d1qd0a1 (1qd0 A:6-128)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739533Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 2739573Species Llama (Lama glama) [TaxId:9844] [88565] (7 PDB entries)
  8. 2739579Domain d1qd0a1: 1qd0 A:6-128 [20515]
    Other proteins in same PDB: d1qd0a2
    anti-RR6 VH domain
    complexed with cu, rr6

Details for d1qd0a1

PDB Entry: 1qd0 (more details), 2.5 Å

PDB Description: camelid heavy chain variable domains provide efficient combining sites to haptens
PDB Compounds: (A:) vhh-r2 anti-rr6 antibody

SCOPe Domain Sequences for d1qd0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qd0a1 b.1.1.1 (A:6-128) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgraasghghygmgwfrqvpgkerefvaairwsgketwykd
svkgrftisrdnakttvylqmnslkgedtavyycaarpvrvadislpvgfdywgqgtqvt
vss

SCOPe Domain Coordinates for d1qd0a1:

Click to download the PDB-style file with coordinates for d1qd0a1.
(The format of our PDB-style files is described here.)

Timeline for d1qd0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qd0a2