Lineage for d2ns7b1 (2ns7 B:3-67)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1258262Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1258448Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. 1258449Species Escherichia coli [TaxId:562] [46766] (25 PDB entries)
  8. 1258475Domain d2ns7b1: 2ns7 B:3-67 [205149]
    Other proteins in same PDB: d2ns7a2, d2ns7b2, d2ns7c2, d2ns7d2
    automated match to d1qpia1

Details for d2ns7b1

PDB Entry: 2ns7 (more details), 2.4 Å

PDB Description: how an in vitro selected peptide mimics the antibiotic tetracycline to induce tet repressor
PDB Compounds: (B:) Tetracycline repressor protein

SCOPe Domain Sequences for d2ns7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ns7b1 a.4.1.9 (B:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
rldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaiemldr
hhthf

SCOPe Domain Coordinates for d2ns7b1:

Click to download the PDB-style file with coordinates for d2ns7b1.
(The format of our PDB-style files is described here.)

Timeline for d2ns7b1: