Lineage for d2npmb_ (2npm B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007216Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2007217Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2007267Protein automated matches [190238] (9 species)
    not a true protein
  7. 2007273Species Cryptosporidium parvum [TaxId:5807] [225171] (1 PDB entry)
  8. 2007275Domain d2npmb_: 2npm B: [205146]
    automated match to d3axyc_

Details for d2npmb_

PDB Entry: 2npm (more details), 2.52 Å

PDB Description: crystal structure of cryptosporidium parvum 14-3-3 protein in complex with peptide
PDB Compounds: (B:) 14-3-3 domain containing protein

SCOPe Domain Sequences for d2npmb_:

Sequence, based on SEQRES records: (download)

>d2npmb_ a.118.7.1 (B:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
svnaresnvymaklaeqaerydemakymkdvvearqeseeltveernllsvayknavgsr
rsswriissveqkehsrnaedaskmcgkyrskveaeltdicndiltmldkhliptatspd
skvfyfkmkgdyhryisefstgdskqssaedalkaykdatvvakdlepthpirlglalnf
svfhyeilnepraaidmakeafemaieqldklsedcykdstlimqllrdnltlwta

Sequence, based on observed residues (ATOM records): (download)

>d2npmb_ a.118.7.1 (B:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
svnaresnvymaklaeqaerydemakymkdvvearqseeltveernllsvayknavgsrr
sswriissveqkehsrnaedaskmcgkyrskveaeltdicndiltmldkhliptatspds
kvfyfkmkgdyhryisefstgdskqssaedalkaykdatvvakdlepthpirlglalnfs
vfhyeilnepraaidmakeafemaieqldklsedcykdstlimqllrdnltlwta

SCOPe Domain Coordinates for d2npmb_:

Click to download the PDB-style file with coordinates for d2npmb_.
(The format of our PDB-style files is described here.)

Timeline for d2npmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2npma_