Lineage for d1hcva_ (1hcv A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755462Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 1755502Species Llama (Lama glama) [TaxId:9844] [88565] (7 PDB entries)
  8. 1755504Domain d1hcva_: 1hcv A: [20514]
    anti-gonadotropin alpha subunit VHh domain

Details for d1hcva_

PDB Entry: 1hcv (more details), 1.85 Å

PDB Description: llama heavy chain variable domain against alpha subunit of hcg (human chorionic gonadotropin)
PDB Compounds: (A:) immunoglobulin g

SCOPe Domain Sequences for d1hcva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyya
ssvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss

SCOPe Domain Coordinates for d1hcva_:

Click to download the PDB-style file with coordinates for d1hcva_.
(The format of our PDB-style files is described here.)

Timeline for d1hcva_: