SCOP 1.63: Domain d1hcv__: 1hcv -

Lineage for d1hcv__ (1hcv -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Llama (Lama glama), anti-gonadotropin alpha subunit VH domain [48917] (2 PDB entries)

8. Domain d1hcv__: 1hcv - [20514]

Details for d1hcv__

PDB Entry: 1hcv, 1.85 Å

PDB Description: llama heavy chain variable domain against alpha subunit of hcg (human chorionic gonadotropin)

SCOP Domain Sequences for d1hcv__:

Sequence; same for both SEQRES and ATOM records:

>d1hcv__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Llama (Lama glama), anti-gonadotropin alpha subunit VH domain}
vqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyya
ssvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss

Timeline for d1hcv__:

• d1hcv__ first appeared (with stable ids) in SCOP 1.55
  
• d1hcv__ appears in SCOP 1.61
  
• d1hcv__ appears in SCOP 1.65
  
• d1hcv__ appears in the current release, SCOPe 2.08, called d1hcva_