Lineage for d1hcv__ (1hcv -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 8002Species Llama (Lama glama), anti-gonadotropin alpha subunit VH domain [48917] (1 PDB entry)
  8. 8003Domain d1hcv__: 1hcv - [20514]

Details for d1hcv__

PDB Entry: 1hcv (more details), 1.85 Å

PDB Description: llama heavy chain variable domain against alpha subunit of hcg (human chorionic gonadotropin)

SCOP Domain Sequences for d1hcv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcv__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Llama (Lama glama), anti-gonadotropin alpha subunit VH domain}
vqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyya
ssvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss

SCOP Domain Coordinates for d1hcv__:

Click to download the PDB-style file with coordinates for d1hcv__.
(The format of our PDB-style files is described here.)

Timeline for d1hcv__: