SCOPe 2.08: Domain d1hcva_: 1hcv A:

Lineage for d1hcva_ (1hcv A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Llama (Lama glama) [TaxId:9844] [88565] (7 PDB entries)

8. Domain d1hcva_: 1hcv A: [20514]
   anti-gonadotropin alpha subunit VHh domain

Details for d1hcva_

PDB Entry: 1hcv, 1.85 Å

PDB Description: llama heavy chain variable domain against alpha subunit of hcg (human chorionic gonadotropin)

PDB Compounds: (A:) immunoglobulin g

SCOPe Domain Sequences for d1hcva_:

Sequence; same for both SEQRES and ATOM records:

>d1hcva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyya
ssvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss

Timeline for d1hcva_:

• d1hcva_ first appeared (with stable ids) in SCOP 1.55, called d1hcv__
  
• d1hcva_ appears in SCOPe 2.07