![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily) multihelical; bundle, contains interrupted helices |
![]() | Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) ![]() contains heme-dependent enzymes |
![]() | Family a.266.1.0: automated matches [227197] (1 protein) not a true family |
![]() | Protein automated matches [226924] (2 species) not a true protein |
![]() | Species Cupriavidus metallidurans [TaxId:119219] [225197] (1 PDB entry) |
![]() | Domain d2noxi_: 2nox I: [205137] automated match to d2nw8a1 complexed with hem |
PDB Entry: 2nox (more details), 2.4 Å
SCOPe Domain Sequences for d2noxi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2noxi_ a.266.1.0 (I:) automated matches {Cupriavidus metallidurans [TaxId: 119219]} msygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdqlqp afkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnkna amlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynasve aawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkrgtggtegvsyl rrmldvvlfpelwklrtdl
Timeline for d2noxi_: