Lineage for d2noxi_ (2nox I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738610Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 2738611Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 2738757Family a.266.1.0: automated matches [227197] (1 protein)
    not a true family
  6. 2738758Protein automated matches [226924] (2 species)
    not a true protein
  7. 2738759Species Cupriavidus metallidurans [TaxId:119219] [225197] (1 PDB entry)
  8. 2738768Domain d2noxi_: 2nox I: [205137]
    automated match to d2nw8a1
    complexed with hem

Details for d2noxi_

PDB Entry: 2nox (more details), 2.4 Å

PDB Description: crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans
PDB Compounds: (I:) Tryptophan 2,3-dioxygenase

SCOPe Domain Sequences for d2noxi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2noxi_ a.266.1.0 (I:) automated matches {Cupriavidus metallidurans [TaxId: 119219]}
msygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdqlqp
afkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnkna
amlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynasve
aawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkrgtggtegvsyl
rrmldvvlfpelwklrtdl

SCOPe Domain Coordinates for d2noxi_:

Click to download the PDB-style file with coordinates for d2noxi_.
(The format of our PDB-style files is described here.)

Timeline for d2noxi_: