Lineage for d1g6vk_ (1g6v K:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103277Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 1103278Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
    SQ NA # camelid antibody
  8. 1103311Domain d1g6vk_: 1g6v K: [20513]
    Other proteins in same PDB: d1g6va_
    cVH of antibody cab-ca05
    complexed with zn

Details for d1g6vk_

PDB Entry: 1g6v (more details), 3.5 Å

PDB Description: Complex of the camelid heavy-chain antibody fragment CAB-CA05 with bovine carbonic anhydrase
PDB Compounds: (K:) antibody heavy chain

SCOPe Domain Sequences for d1g6vk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6vk_ b.1.1.1 (K:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygd
svkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgt
qvtvss

SCOPe Domain Coordinates for d1g6vk_:

Click to download the PDB-style file with coordinates for d1g6vk_.
(The format of our PDB-style files is described here.)

Timeline for d1g6vk_: