SCOP 1.61: Domain d1g6vk_: 1g6v K:

Lineage for d1g6vk_ (1g6v K:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Camel (Camelus dromedarius), antibody cab-ca05 [48916] (2 PDB entries)

8. Domain d1g6vk_: 1g6v K: [20513]
   Other proteins in same PDB: d1g6va_

Details for d1g6vk_

PDB Entry: 1g6v, 3.5 Å

PDB Description: Complex of the camelid heavy-chain antibody fragment CAB-CA05 with bovine carbonic anhydrase

SCOP Domain Sequences for d1g6vk_:

Sequence; same for both SEQRES and ATOM records:

>d1g6vk_ b.1.1.1 (K:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), antibody cab-ca05}
qvqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygd
svkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgt
qvtvss

Timeline for d1g6vk_:

• d1g6vk_ first appeared (with stable ids) in SCOP 1.55
  
• d1g6vk_ appears in SCOP 1.59
  
• d1g6vk_ appears in SCOP 1.63
  
• d1g6vk_ appears in the current release, SCOPe 2.08