Lineage for d1g6vk_ (1g6v K:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Camel (Camelus dromedarius), antibody cab-ca05 [48916] (2 PDB entries) 
Domain d1g6vk_: 1g6v K: [20513]
Other proteins in same PDB: d1g6va_
Details for d1g6vk_
PDB Entry: 1g6v (more details), 3.5 Å
PDB Description: Complex of the camelid heavy-chain antibody fragment CAB-CA05 with bovine carbonic anhydrase
SCOP Domain Sequences for d1g6vk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6vk_ b.1.1.1 (K:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), antibody cab-ca05}
qvqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygd
svkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgt
qvtvss
SCOP Domain Coordinates for d1g6vk_:
Click to download the PDB-style file with coordinates for d1g6vk_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g6vk_:
- d1g6vk_ appears in SCOP 1.57
- d1g6vk_ appears in the current release, SCOPe 2.08
View in 3D
