Lineage for d2noia1 (2noi A:8-135)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431003Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1431115Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
    contains a single copy of this fold
  6. 1431156Protein 8-oxoguanine glycosylase [55955] (1 species)
  7. 1431157Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)
  8. 1431172Domain d2noia1: 2noi A:8-135 [205127]
    Other proteins in same PDB: d2noia2
    automated match to d1m3qa2
    protein/DNA complex; complexed with ca

Details for d2noia1

PDB Entry: 2noi (more details), 2.35 Å

PDB Description: structure of g42a human 8-oxoguanine glycosylase crosslinked to undamaged g-containing dna
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2noia1:

Sequence, based on SEQRES records: (download)

>d2noia1 d.129.1.2 (A:8-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gsefghrtlastpalwasipcprselrldlvlpsaqsfrwreqspahwsgvladqvwtlt
qteeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkf
qgvrllrq

Sequence, based on observed residues (ATOM records): (download)

>d2noia1 d.129.1.2 (A:8-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gsefghrtlastpalwasipcprselrldlvlpsaqsfrwreqspahwsgvladqvwtlt
qteeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgv
rllrq

SCOPe Domain Coordinates for d2noia1:

Click to download the PDB-style file with coordinates for d2noia1.
(The format of our PDB-style files is described here.)

Timeline for d2noia1: