![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
![]() | Protein automated matches [190674] (25 species) not a true protein |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [225308] (1 PDB entry) |
![]() | Domain d2nogb2: 2nog B:828-895 [205126] Other proteins in same PDB: d2noga1, d2nogb1 automated match to d1ofcx1 complexed with mg |
PDB Entry: 2nog (more details), 2 Å
SCOPe Domain Sequences for d2nogb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nogb2 a.4.1.0 (B:828-895) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} nwnkrdfnqfikanekwgrddieniarevegktpeevieysavfwercnelqdiektmaq iergeari
Timeline for d2nogb2: