SCOPe 2.08: Domain d2nogb2: 2nog B:828-895

Lineage for d2nogb2 (2nog B:828-895)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [225308] (1 PDB entry)

8. Domain d2nogb2: 2nog B:828-895 [205126]
   Other proteins in same PDB: d2noga1, d2nogb1
   automated match to d1ofcx1
   complexed with mg

Details for d2nogb2

PDB Entry: 2nog, 2 Å

PDB Description: SANT Domain Structure of Xenopus Remodeling Factor ISWI

PDB Compounds: (B:) iswi protein

SCOPe Domain Sequences for d2nogb2:

Sequence; same for both SEQRES and ATOM records:

>d2nogb2 a.4.1.0 (B:828-895) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
nwnkrdfnqfikanekwgrddieniarevegktpeevieysavfwercnelqdiektmaq
iergeari

Timeline for d2nogb2:

• d2nogb2 first appeared in SCOPe 2.03
  
• d2nogb2 appears in SCOPe 2.07