Lineage for d2nogb1 (2nog B:739-827)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736185Fold a.187: HAND domain of the nucleosome remodeling ATPase ISWI [101223] (1 superfamily)
    4 helices; irregular array
  4. 2736186Superfamily a.187.1: HAND domain of the nucleosome remodeling ATPase ISWI [101224] (2 families) (S)
    automatically mapped to Pfam PF09110
  5. 2736191Family a.187.1.0: automated matches [227213] (1 protein)
    not a true family
  6. 2736192Protein automated matches [226949] (1 species)
    not a true protein
  7. 2736193Species African clawed frog (Xenopus laevis) [TaxId:8355] [225307] (1 PDB entry)
  8. 2736195Domain d2nogb1: 2nog B:739-827 [205125]
    Other proteins in same PDB: d2nogb2
    automated match to d1ofcx3
    complexed with mg

Details for d2nogb1

PDB Entry: 2nog (more details), 2 Å

PDB Description: SANT Domain Structure of Xenopus Remodeling Factor ISWI
PDB Compounds: (B:) iswi protein

SCOPe Domain Sequences for d2nogb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nogb1 a.187.1.0 (B:739-827) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
epkvpkaprppkqpnvqdfqffpprlfellekeilyyrktigykvprnpdlpnsaqvqke
eqlkideaeplndeeleekeklltqgft

SCOPe Domain Coordinates for d2nogb1:

Click to download the PDB-style file with coordinates for d2nogb1.
(The format of our PDB-style files is described here.)

Timeline for d2nogb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nogb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2noga1