| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.187: HAND domain of the nucleosome remodeling ATPase ISWI [101223] (1 superfamily) 4 helices; irregular array |
Superfamily a.187.1: HAND domain of the nucleosome remodeling ATPase ISWI [101224] (2 families) ![]() automatically mapped to Pfam PF09110 |
| Family a.187.1.0: automated matches [227213] (1 protein) not a true family |
| Protein automated matches [226949] (1 species) not a true protein |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [225307] (1 PDB entry) |
| Domain d2noga1: 2nog A:739-827 [205124] Other proteins in same PDB: d2nogb2 automated match to d1ofcx3 complexed with mg |
PDB Entry: 2nog (more details), 2 Å
SCOPe Domain Sequences for d2noga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2noga1 a.187.1.0 (A:739-827) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
epkvpkaprppkqpnvqdfqffpprlfellekeilyyrktigykvprnpdlpnsaqvqke
eqlkideaeplndeeleekeklltqgft
Timeline for d2noga1: