SCOPe 2.03: Domain d2nnya_: 2nny A:

Lineage for d2nnya_ (2nny A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein automated matches [191121] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193283] (2 PDB entries)

8. Domain d2nnya_: 2nny A: [205118]
   automated match to d1gvja_
   protein/DNA complex

Details for d2nnya_

PDB Entry: 2nny, 2.58 Å

PDB Description: crystal structure of the ets1 dimer dna complex.

PDB Compounds: (A:) c-ets-1 protein

SCOPe Domain Sequences for d2nnya_:

Sequence; same for both SEQRES and ATOM records:

>d2nnya_ a.4.5.21 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrdradlnkdkpvipaaalagytgsgpiqlwqfllelltdkssqsfiswtgdgwefklsd
pdevarrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfvsdlqsllgytpe
elhamldvk

Timeline for d2nnya_:

• d2nnya_ is new in SCOPe 2.03-stable
  
• d2nnya_ appears in SCOPe 2.04
  
• d2nnya_ appears in the current release, SCOPe 2.08