Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (3 species) |
Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries) |
Domain d2nljc_: 2nlj C: [205117] Other proteins in same PDB: d2nlja1, d2nlja2, d2nljb1, d2nljb2, d2nljb3 automated match to d1s5hc_ complexed with dga, k |
PDB Entry: 2nlj (more details), 2.52 Å
SCOPe Domain Sequences for d2nljc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nljc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvvvagitsfglvtaalatwfvgreqerrgh
Timeline for d2nljc_: