SCOPe 2.08: Domain d2jlea2: 2jle A:430-545

Lineage for d2jlea2 (2jle A:430-545)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries)

8. Domain d2jlea2: 2jle A:430-545 [205112]
   Other proteins in same PDB: d2jlea1, d2jleb_
   automated match to d1bqna1
   complexed with i15

Details for d2jlea2

PDB Entry: 2jle, 2.9 Å

PDB Description: novel indazole nnrtis created using molecular template hybridization based on crystallographic overlays

PDB Compounds: (A:) Reverse transcriptase/RNaseH

SCOPe Domain Sequences for d2jlea2:

Sequence; same for both SEQRES and ATOM records:

>d2jlea2 c.55.3.0 (A:430-545) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggn

Timeline for d2jlea2:

• d2jlea2 first appeared in SCOPe 2.03
  
• d2jlea2 appears in SCOPe 2.07