SCOPe 2.08: Domain d2jlea1: 2jle A:1-429

Lineage for d2jlea1 (2jle A:1-429)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (7 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [186967] (7 PDB entries)

8. Domain d2jlea1: 2jle A:1-429 [205111]
   Other proteins in same PDB: d2jlea2
   automated match to d1bqna2
   complexed with i15

Details for d2jlea1

PDB Entry: 2jle, 2.9 Å

PDB Description: novel indazole nnrtis created using molecular template hybridization based on crystallographic overlays

PDB Compounds: (A:) Reverse transcriptase/RNaseH

SCOPe Domain Sequences for d2jlea1:

Sequence; same for both SEQRES and ATOM records:

>d2jlea1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d2jlea1:

• d2jlea1 first appeared in SCOPe 2.03
  
• d2jlea1 appears in SCOPe 2.07