SCOPe 2.07: Domain d1f2xk_: 1f2x K:

Lineage for d1f2xk_ (1f2x K:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
   SQ NA # camelid antibody

8. Domain d1f2xk_: 1f2x K: [20511]
   VHh of antibody cab-ca05

Details for d1f2xk_

PDB Entry: 1f2x, 2.1 Å

PDB Description: structure of the single-domain camelid antibody cab-ca05

PDB Compounds: (K:) antibody heavy chain

SCOPe Domain Sequences for d1f2xk_:

Sequence; same for both SEQRES and ATOM records:

>d1f2xk_ b.1.1.1 (K:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygd
svkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgt
qvtvss

Timeline for d1f2xk_:

• d1f2xk_ first appeared (with stable ids) in SCOP 1.55
  
• d1f2xk_ appears in SCOPe 2.06
  
• d1f2xk_ appears in the current release, SCOPe 2.08