Lineage for d1f2xk_ (1f2x K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739533Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 2739534Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
    SQ NA # camelid antibody
  8. 2739556Domain d1f2xk_: 1f2x K: [20511]
    VHh of antibody cab-ca05

Details for d1f2xk_

PDB Entry: 1f2x (more details), 2.1 Å

PDB Description: structure of the single-domain camelid antibody cab-ca05
PDB Compounds: (K:) antibody heavy chain

SCOPe Domain Sequences for d1f2xk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2xk_ b.1.1.1 (K:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygd
svkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgt
qvtvss

SCOPe Domain Coordinates for d1f2xk_:

Click to download the PDB-style file with coordinates for d1f2xk_.
(The format of our PDB-style files is described here.)

Timeline for d1f2xk_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f2xl_