Lineage for d2jl4b1 (2jl4 B:1-79)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880228Species Ralstonia sp. [TaxId:70356] [225492] (2 PDB entries)
  8. 2880232Domain d2jl4b1: 2jl4 B:1-79 [205107]
    Other proteins in same PDB: d2jl4a2, d2jl4b2
    automated match to d1e6ba2
    complexed with gsh

Details for d2jl4b1

PDB Entry: 2jl4 (more details), 2.3 Å

PDB Description: holo structure of maleyl pyruvate isomerase, a bacterial glutathione-s-transferase in zeta class
PDB Compounds: (B:) maleylpyruvate isomerase

SCOPe Domain Sequences for d2jl4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jl4b1 c.47.1.0 (B:1-79) automated matches {Ralstonia sp. [TaxId: 70356]}
mklynfwrsgtshrlrialnlkgvpyeylavhlgkeehlkdafkalnpqqlvpaldtgaq
vliqspaiiewleeqyptp

SCOPe Domain Coordinates for d2jl4b1:

Click to download the PDB-style file with coordinates for d2jl4b1.
(The format of our PDB-style files is described here.)

Timeline for d2jl4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jl4b2