SCOPe 2.08: Domain d2jl4a1: 2jl4 A:1-79

Lineage for d2jl4a1 (2jl4 A:1-79)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Ralstonia sp. [TaxId:70356] [225492] (2 PDB entries)

8. Domain d2jl4a1: 2jl4 A:1-79 [205105]
   Other proteins in same PDB: d2jl4a2, d2jl4b2
   automated match to d1e6ba2
   complexed with gsh

Details for d2jl4a1

PDB Entry: 2jl4, 2.3 Å

PDB Description: holo structure of maleyl pyruvate isomerase, a bacterial glutathione-s-transferase in zeta class

PDB Compounds: (A:) maleylpyruvate isomerase

SCOPe Domain Sequences for d2jl4a1:

Sequence; same for both SEQRES and ATOM records:

>d2jl4a1 c.47.1.0 (A:1-79) automated matches {Ralstonia sp. [TaxId: 70356]}
mklynfwrsgtshrlrialnlkgvpyeylavhlgkeehlkdafkalnpqqlvpaldtgaq
vliqspaiiewleeqyptp

Timeline for d2jl4a1:

• d2jl4a1 first appeared in SCOPe 2.03
  
• d2jl4a1 appears in SCOPe 2.07