SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2jl4a1 (2jl4 A:1-79)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (157 species)
    not a true protein
  7. 2119962Species Ralstonia sp. [TaxId:70356] [225492] (2 PDB entries)
  8. 2119965Domain d2jl4a1: 2jl4 A:1-79 [205105]
    Other proteins in same PDB: d2jl4a2, d2jl4b2
    automated match to d1e6ba2
    complexed with gsh

Details for d2jl4a1

PDB Entry: 2jl4 (more details), 2.3 Å

PDB Description: holo structure of maleyl pyruvate isomerase, a bacterial glutathione-s-transferase in zeta class
PDB Compounds: (A:) maleylpyruvate isomerase

SCOPe Domain Sequences for d2jl4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jl4a1 c.47.1.0 (A:1-79) automated matches {Ralstonia sp. [TaxId: 70356]}
mklynfwrsgtshrlrialnlkgvpyeylavhlgkeehlkdafkalnpqqlvpaldtgaq
vliqspaiiewleeqyptp

SCOPe Domain Coordinates for d2jl4a1:

Click to download the PDB-style file with coordinates for d2jl4a1.
(The format of our PDB-style files is described here.)

Timeline for d2jl4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jl4a2