Lineage for d2jkvd2 (2jkv D:178-483)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003567Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2003568Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2003777Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2003778Protein automated matches [226851] (35 species)
    not a true protein
  7. 2003852Species Human (Homo sapiens) [TaxId:9606] [225061] (18 PDB entries)
  8. 2003878Domain d2jkvd2: 2jkv D:178-483 [205100]
    Other proteins in same PDB: d2jkva1, d2jkvb1, d2jkvc1, d2jkvd1, d2jkve1, d2jkvf1
    automated match to d1pgja1
    complexed with cl, nap, so4

Details for d2jkvd2

PDB Entry: 2jkv (more details), 2.53 Å

PDB Description: Structure of human Phosphogluconate Dehydrogenase in complex with NADPH at 2.53A
PDB Compounds: (D:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2jkvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jkvd2 a.100.1.0 (D:178-483) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieita
nilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder
iqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg
ialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqag
ipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtghggtvs
sssyna

SCOPe Domain Coordinates for d2jkvd2:

Click to download the PDB-style file with coordinates for d2jkvd2.
(The format of our PDB-style files is described here.)

Timeline for d2jkvd2: