| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
| Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries) SQ NA # camelid antibody |
| Domain d1bzqn_: 1bzq N: [20510] Other proteins in same PDB: d1bzqa_, d1bzqb_, d1bzqc_, d1bzqd_ anti-RNase A VHh domain protein/RNA complex; complexed with po4 |
PDB Entry: 1bzq (more details), 2.8 Å
SCOPe Domain Sequences for d1bzqn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzqn_ b.1.1.1 (N:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
srgr
Timeline for d1bzqn_: