Lineage for d2jkva2 (2jkv A:178-483)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721650Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2721730Domain d2jkva2: 2jkv A:178-483 [205094]
    Other proteins in same PDB: d2jkva1, d2jkvb1, d2jkvc1, d2jkvd1, d2jkve1, d2jkvf1
    automated match to d1pgja1
    complexed with cl, nap, so4

Details for d2jkva2

PDB Entry: 2jkv (more details), 2.53 Å

PDB Description: structure of human phosphogluconate dehydrogenase in complex with nadph at 2.53a
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2jkva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jkva2 a.100.1.0 (A:178-483) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieita
nilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder
iqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg
ialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqag
ipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtghggtvs
sssyna

SCOPe Domain Coordinates for d2jkva2:

Click to download the PDB-style file with coordinates for d2jkva2.
(The format of our PDB-style files is described here.)

Timeline for d2jkva2: