Lineage for d2jknf1 (2jkn F:2-139)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377593Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 2377594Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 2377595Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. 2377613Domain d2jknf1: 2jkn F:2-139 [205092]
    Other proteins in same PDB: d2jkna2, d2jknb2, d2jknc2, d2jknd2, d2jkne2, d2jknf2
    automated match to d1usqf_
    complexed with cl8, edo, so4

Details for d2jknf1

PDB Entry: 2jkn (more details), 1.9 Å

PDB Description: drae adhesin in complex with chloramphenicol succinate (trigonal form)
PDB Compounds: (F:) dr hemagglutinin structural subunit

SCOPe Domain Sequences for d2jknf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jknf1 b.2.3.6 (F:2-139) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
ftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalkad
tdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgqqt
ntppgnytltltggywak

SCOPe Domain Coordinates for d2jknf1:

Click to download the PDB-style file with coordinates for d2jknf1.
(The format of our PDB-style files is described here.)

Timeline for d2jknf1: