SCOPe 2.06: Domain d2jknf1: 2jkn F:2-139

Lineage for d2jknf1 (2jkn F:2-139)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
   Pfam PF04619

6. Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)

7. Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
   Uniprot Q57254 P24093 23-159

8. Domain d2jknf1: 2jkn F:2-139 [205092]
   Other proteins in same PDB: d2jkna2, d2jknb2, d2jknc2, d2jknd2, d2jkne2, d2jknf2
   automated match to d1usqf_
   complexed with cl8, edo, so4

Details for d2jknf1

PDB Entry: 2jkn, 1.9 Å

PDB Description: drae adhesin in complex with chloramphenicol succinate (trigonal form)

PDB Compounds: (F:) dr hemagglutinin structural subunit

SCOPe Domain Sequences for d2jknf1:

Sequence; same for both SEQRES and ATOM records:

>d2jknf1 b.2.3.6 (F:2-139) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
ftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalkad
tdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgqqt
ntppgnytltltggywak

Timeline for d2jknf1:

• d2jknf1 first appeared in SCOPe 2.03, called d2jknf_
  
• d2jknf1 was called d2jknf_ in SCOPe 2.05
  
• d2jknf1 appears in SCOPe 2.07
  
• d2jknf1 appears in the current release, SCOPe 2.08