Lineage for d2jkne_ (2jkn E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1525229Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1525399Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1525625Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 1525626Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 1525627Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. 1525644Domain d2jkne_: 2jkn E: [205091]
    automated match to d1usqa_
    complexed with cl8, edo, so4

Details for d2jkne_

PDB Entry: 2jkn (more details), 1.9 Å

PDB Description: drae adhesin in complex with chloramphenicol succinate (trigonal form)
PDB Compounds: (E:) dr hemagglutinin structural subunit

SCOPe Domain Sequences for d2jkne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jkne_ b.2.3.6 (E:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
qtntppgnytltltggywa

SCOPe Domain Coordinates for d2jkne_:

Click to download the PDB-style file with coordinates for d2jkne_.
(The format of our PDB-style files is described here.)

Timeline for d2jkne_: