Lineage for d1bzqm_ (1bzq M:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739533Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 2739534Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
    SQ NA # camelid antibody
  8. 2739561Domain d1bzqm_: 1bzq M: [20509]
    Other proteins in same PDB: d1bzqa_, d1bzqb_, d1bzqc_, d1bzqd_
    anti-RNase A VHh domain
    protein/RNA complex; complexed with po4

Details for d1bzqm_

PDB Entry: 1bzq (more details), 2.8 Å

PDB Description: complex of a dromedary single-domain vhh antibody fragment with rnase a
PDB Compounds: (M:) protein (antibody cab-rn05)

SCOPe Domain Sequences for d1bzqm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzqm_ b.1.1.1 (M:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
srgr

SCOPe Domain Coordinates for d1bzqm_:

Click to download the PDB-style file with coordinates for d1bzqm_.
(The format of our PDB-style files is described here.)

Timeline for d1bzqm_: