| Class b: All beta proteins [48724] (178 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.6: Dr-family adhesin [110075] (1 protein) Pfam PF04619 |
| Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species) |
| Species Escherichia coli [TaxId:562] [110077] (11 PDB entries) Uniprot Q57254 P24093 23-159 |
| Domain d2jkna1: 2jkn A:2-138 [205087] Other proteins in same PDB: d2jkna2, d2jknb2, d2jknc2, d2jknd2, d2jkne2, d2jknf2 automated match to d1usqa_ complexed with cl8, edo, so4 |
PDB Entry: 2jkn (more details), 1.9 Å
SCOPe Domain Sequences for d2jkna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jkna1 b.2.3.6 (A:2-138) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
ftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalkad
tdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgqqt
ntppgnytltltggywa
Timeline for d2jkna1: