SCOPe 2.06: Domain d2jkld1: 2jkl D:2-138

Lineage for d2jkld1 (2jkl D:2-138)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
   Pfam PF04619

6. Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)

7. Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
   Uniprot Q57254 P24093 23-159

8. Domain d2jkld1: 2jkl D:2-138 [205084]
   Other proteins in same PDB: d2jkla2, d2jklb2, d2jklc2, d2jkld2, d2jkle2, d2jklf2
   automated match to d1usqa_
   complexed with brx, clm, edo, so4

Details for d2jkld1

PDB Entry: 2jkl, 1.9 Å

PDB Description: drae adhesin in complex with bromamphenicol

PDB Compounds: (D:) dr hemagglutinin structural subunit

SCOPe Domain Sequences for d2jkld1:

Sequence; same for both SEQRES and ATOM records:

>d2jkld1 b.2.3.6 (D:2-138) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
ftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalkad
tdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgqqt
ntppgnytltltggywa

Timeline for d2jkld1:

• d2jkld1 first appeared in SCOPe 2.03, called d2jkld_
  
• d2jkld1 was called d2jkld_ in SCOPe 2.05
  
• d2jkld1 appears in SCOPe 2.07
  
• d2jkld1 appears in the current release, SCOPe 2.08