Lineage for d2jklc1 (2jkl C:2-138)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040841Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 2040842Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 2040843Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. 2040852Domain d2jklc1: 2jkl C:2-138 [205083]
    Other proteins in same PDB: d2jkla2, d2jklb2, d2jklc2, d2jkld2, d2jkle2, d2jklf2
    automated match to d1usqa_
    complexed with brx, clm, edo, so4

Details for d2jklc1

PDB Entry: 2jkl (more details), 1.9 Å

PDB Description: drae adhesin in complex with bromamphenicol
PDB Compounds: (C:) dr hemagglutinin structural subunit

SCOPe Domain Sequences for d2jklc1:

Sequence, based on SEQRES records: (download)

>d2jklc1 b.2.3.6 (C:2-138) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
ftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalkad
tdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgqqt
ntppgnytltltggywa

Sequence, based on observed residues (ATOM records): (download)

>d2jklc1 b.2.3.6 (C:2-138) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
ftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalkad
tdnfegkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgqqtn
tppgnytltltggywa

SCOPe Domain Coordinates for d2jklc1:

Click to download the PDB-style file with coordinates for d2jklc1.
(The format of our PDB-style files is described here.)

Timeline for d2jklc1: