Lineage for d2jklb_ (2jkl B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300679Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1300898Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 1300899Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 1300900Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. 1300908Domain d2jklb_: 2jkl B: [205082]
    automated match to d1usqa_
    complexed with brx, clm, edo, so4

Details for d2jklb_

PDB Entry: 2jkl (more details), 1.9 Å

PDB Description: drae adhesin in complex with bromamphenicol
PDB Compounds: (B:) dr hemagglutinin structural subunit

SCOPe Domain Sequences for d2jklb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jklb_ b.2.3.6 (B:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
qtntppgnytltltggywa

SCOPe Domain Coordinates for d2jklb_:

Click to download the PDB-style file with coordinates for d2jklb_.
(The format of our PDB-style files is described here.)

Timeline for d2jklb_: