Lineage for d2jkje_ (2jkj E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300679Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1300898Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 1300899Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 1300900Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. 1300932Domain d2jkje_: 2jkj E: [205079]
    automated match to d1usqa_
    complexed with clm, so4, th8

Details for d2jkje_

PDB Entry: 2jkj (more details), 2.3 Å

PDB Description: drae adhesin in complex with chloramphenicol succinate
PDB Compounds: (E:) dr hemagglutinin structural subunit

SCOPe Domain Sequences for d2jkje_:

Sequence, based on SEQRES records: (download)

>d2jkje_ b.2.3.6 (E:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
qtntppgnytltltggywa

Sequence, based on observed residues (ATOM records): (download)

>d2jkje_ b.2.3.6 (E:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfefflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgqqtn
tppgnytltltggywa

SCOPe Domain Coordinates for d2jkje_:

Click to download the PDB-style file with coordinates for d2jkje_.
(The format of our PDB-style files is described here.)

Timeline for d2jkje_: