SCOPe 2.08: Domain d2jkjb1: 2jkj B:2-138

Lineage for d2jkjb1 (2jkj B:2-138)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
   Pfam PF04619

6. Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)

7. Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
   Uniprot Q57254 P24093 23-159

8. Domain d2jkjb1: 2jkj B:2-138 [205076]
   Other proteins in same PDB: d2jkja2, d2jkjb2, d2jkjc2, d2jkjd2, d2jkje2, d2jkjf2
   automated match to d1usqa_
   complexed with clm, so4, th8

Details for d2jkjb1

PDB Entry: 2jkj, 2.3 Å

PDB Description: drae adhesin in complex with chloramphenicol succinate

PDB Compounds: (B:) dr hemagglutinin structural subunit

SCOPe Domain Sequences for d2jkjb1:

Sequence, based on SEQRES records:

>d2jkjb1 b.2.3.6 (B:2-138) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
ftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalkad
tdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgqqt
ntppgnytltltggywa

Sequence, based on observed residues (ATOM records):

>d2jkjb1 b.2.3.6 (B:2-138) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
ftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalkad
tdnfeqgkfflisdnnrdklyvnirptdsawttdngvfykndvgswggiigiyvdgqqtn
tppgnytltltggywa

Timeline for d2jkjb1:

• d2jkjb1 first appeared in SCOPe 2.03, called d2jkjb_
  
• d2jkjb1 appears in SCOPe 2.07