Lineage for d2jkja1 (2jkj A:2-138)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767793Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 2767794Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 2767795Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. 2767823Domain d2jkja1: 2jkj A:2-138 [205075]
    Other proteins in same PDB: d2jkja2, d2jkjb2, d2jkjc2, d2jkjd2, d2jkje2, d2jkjf2
    automated match to d1usqa_
    complexed with clm, so4, th8

Details for d2jkja1

PDB Entry: 2jkj (more details), 2.3 Å

PDB Description: drae adhesin in complex with chloramphenicol succinate
PDB Compounds: (A:) dr hemagglutinin structural subunit

SCOPe Domain Sequences for d2jkja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jkja1 b.2.3.6 (A:2-138) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
ftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalkad
tdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgqqt
ntppgnytltltggywa

SCOPe Domain Coordinates for d2jkja1:

Click to download the PDB-style file with coordinates for d2jkja1.
(The format of our PDB-style files is described here.)

Timeline for d2jkja1: